EST1F_RAT   Q64573


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64573

Recommended name:Liver carboxylesterase 1F Curated

EC number:EC:3.1.1.1

Alternative names:Carboxyesterase ES-4 1 Publication Kidney microsomal carboxylesterase Microsomal palmitoyl-CoA hydrolase

Cleaved into:

GeneID:100125372

Gene names  (primary ):Ces1f

Gene names  (synonym ):

Gene names  (ORF ):

Length:561

Mass:62,308

Sequence:MCLSFLFLVSLATCVVYGNPSSPPVVDTTKGKVLGKYVSLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDAAKGQRMNDLLTNRKEKIHLEFSEDCLYLNIYTPADFTKNSRLPVMVWIHGGGMTLGGASTYDGRVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLTKNLFHRAISESGVVFLPGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKMNLIKLSSQRDNKESYHFLSTVVDNVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMGFVPADVELDKKMAITLLEKFASLYGIPEDIIPVAIEKYRKGSDDSIKIRDGILAFIGDVSFSIPSVMVSRDHRDAGAPTYMYEYQYYPSFSSPQRPKHVVGDHADDLYSVFGAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLAKRQPQPHHNEL

Tissue specificity:Expressed in liver and kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp