COQ7_RAT Q63619
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63619
Recommended name：NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial UniRule Annotation
EC number：EC:1.14.13.253
Alternative names：3-demethoxyubiquinone 3-hydroxylase (NADH) UniRule Annotation Timing protein clk-1 homolog UniRule Annotation Ubiquinone biosynthesis monooxygenase COQ7 UniRule Annotation
Cleaved into：
GeneID：25249
Gene names (primary )：Coq7 UniRule Annotation
Gene names (synonym )：
Gene names (ORF )：
Length：217
Mass：23,870
Sequence：MSGAGAIAAASVGCLRTGVPRPFSAYGRGLIIRCHSTGMTLDNINRAAVDQIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMVAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRMLMEEDAEKYEELLQVIKQFRDEELEHHDTGLEHDAELAPAYTLLKRLIQAGCSAAIYLSERF
Tissue specificity：
Induction：
Developmental stage：
Protein families：