ALX1_RAT Q63087
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63087
Recommended name：ALX homeobox protein 1 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Alx1
Gene names (synonym )：Cart1 By Similarity
Gene names (ORF )：
Length：326
Mass：36,904
Sequence：MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNTSGGSVVTSCMLPRDASSCMTPYSHSPRTDSSYTGFSNHQNQFGHVPLNNFFTDSLLTGTTNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM
Tissue specificity：Expressed in chondrocytes. 1
Induction：
Developmental stage：Expressed in condensed prechondrocytic mesenchymal cells and in early chondrocytes of cartilage primordia. Expression is lower in mature chondrocytes. 1
Protein families：paired homeobox family