DDIT3_RAT Q62857
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62857
Recommended name:DNA damage-inducible transcript 3 protein
EC number:
Alternative names:C/EBP zeta C/EBP-homologous protein (CHOP) C/EBP-homologous protein 10 (CHOP-10) CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153
Cleaved into:
GeneID:
Gene names (primary ):Ddit3
Gene names (synonym ):Chop, Chop10, Gadd153
Gene names (ORF ):
Length:168
Mass:19,013
Sequence:MAAESLPFAFETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMKEKEQENERKVAQLAEENERLKLEIERLTREVETTRRALIDRMVSLHQA
Tissue specificity:
Induction:
Developmental stage:
Protein families:bZIP family