NTCP2_RAT Q62633
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62633
Recommended name：Ileal sodium/bile acid cotransporter
EC number：
Alternative names：
Cleaved into：
GeneID：29500
Gene names (primary )：Slc10a2
Gene names (synonym )：Ntcp2
Gene names (ORF )：
Length：348
Mass：38,024
Sequence：MDNSSVCSPNATFCEGDSCLVTESNFNAILSTVMSTVLTILLAMVMFSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAIILGMYVTYKKCHGKNDAEFLEKTDNDMDPMPSFQETNKGFQPDEK
Tissue specificity：Expressed mainly in ileum and kidney, low levels in cecum and proximal colon. 1
Induction：
Developmental stage：Transcriptionally regulated increases in mRNA and protein levels at the time of weaning. 1
Protein families：