4EBP1_RAT Q62622
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62622
Recommended name:Eukaryotic translation initiation factor 4E-binding protein 1
EC number:
Alternative names:Phosphorylated heat- and acid-stable protein regulated by insulin 1 (PHAS-I)
Cleaved into:
GeneID:116636
Gene names (primary ):Eif4ebp1
Gene names (synonym ):
Gene names (ORF ):
Length:117
Mass:12,404
Sequence:MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI
Tissue specificity:Expressed in all tissues examined; highest levels in fat and skeletal tissue, lowest levels in kidney. 2 s
Induction:
Developmental stage:
Protein families:eIF4E-binding protein family