AB17A_RAT Q5XIJ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5XIJ5
Recommended name:Alpha/beta hydrolase domain-containing protein 17A Curated
EC number:EC:3.1.2.22
Alternative names:Abhydrolase domain-containing protein 17A Imported
Cleaved into:
GeneID:299617
Gene names (primary ):Abhd17a
Gene names (synonym ):
Gene names (ORF ):
Length:310
Mass:33,994
Sequence:MNGLSVSELCCLFCCPPCPGRIAAKLAFLPPEPTYSLVPEPEPGPGGAGAAPSGPLRTSAATPGRWKIHLTERADFQYGQRELDTIEVFVTKSARANRIACMYVRCVPGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRT
Tissue specificity:Expressed in brain (at protein level). Expressed in hippocampal neurons. 1
Induction:
Developmental stage:
Protein families: