KAT3_RAT Q58FK9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q58FK9
Recommended name：Kynurenine--oxoglutarate transaminase 3 By Similarity
EC number：EC:2.6.1.7
Alternative names：Cysteine-S-conjugate beta-lyase 2 By Similarity (EC:4.4.1.13 By Similarity) . EC:4.4.1.13 (UniProtKB | ENZYME | Rhea) By Similarity Kynurenine aminotransferase 3 Imported Kynurenine aminotransferase III (KATIII) Kynurenine--glyoxylate transaminase By Similarity (EC:2.6.1.63 By Similarity) . EC:2.6.1.63 (UniProtKB | ENZYME | Rhea) By Similarity Kynurenine--oxoglutarate transaminase III
Cleaved into：
GeneID：541589
Gene names (primary )：Kyat3
Gene names (synonym )：Ccbl2, Kat3
Gene names (ORF )：
Length：454
Mass：51,044
Sequence：MLLAQRRLFSLGCRAKPIKTIYSSKVLGLSTSAKMALRFKNAKRIEGLDQNVWVEFTKLAADPSVVNLGQGFPDITLPSYVQEELSKAAFIDNLNQYTRGFGHPSLVKALSCLYGKIYQKQIDPNEEILVTVGGYGSLFNAIQGLVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLRSKRTDGMKWTSSDWTFNPQELESKFSSKTKAIILNTPHNPIGKVYTREELQVIADLCIKHDTLCISDEVYEWLVYTGHKHIKVASLPGMWDRTLTIGSAGKTFSVTGWKLGWSIGPGHLIKHLRTVQQTSVYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMACLLNSVGLKPIIPDGGYFIIADVSSLGVDLSDVKSDEPYDYKFVKWMTKNKKLSAIPVSAFCDSESKPHFEKLVRFCFIKKDSTLDAAEEIFRTWNSRKS
Tissue specificity：
Induction：
Developmental stage：
Protein families：