KAT3_RAT   Q58FK9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q58FK9

Recommended name:Kynurenine--oxoglutarate transaminase 3 By Similarity

EC number:EC:2.6.1.7

Alternative names:Cysteine-S-conjugate beta-lyase 2 By Similarity (EC:4.4.1.13 By Similarity) . EC:4.4.1.13 (UniProtKB | ENZYME | Rhea) By Similarity Kynurenine aminotransferase 3 Imported Kynurenine aminotransferase III (KATIII) Kynurenine--glyoxylate transaminase By Similarity (EC:2.6.1.63 By Similarity) . EC:2.6.1.63 (UniProtKB | ENZYME | Rhea) By Similarity Kynurenine--oxoglutarate transaminase III

Cleaved into:

GeneID:541589

Gene names  (primary ):Kyat3

Gene names  (synonym ):Ccbl2, Kat3

Gene names  (ORF ):

Length:454

Mass:51,044

Sequence:MLLAQRRLFSLGCRAKPIKTIYSSKVLGLSTSAKMALRFKNAKRIEGLDQNVWVEFTKLAADPSVVNLGQGFPDITLPSYVQEELSKAAFIDNLNQYTRGFGHPSLVKALSCLYGKIYQKQIDPNEEILVTVGGYGSLFNAIQGLVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLRSKRTDGMKWTSSDWTFNPQELESKFSSKTKAIILNTPHNPIGKVYTREELQVIADLCIKHDTLCISDEVYEWLVYTGHKHIKVASLPGMWDRTLTIGSAGKTFSVTGWKLGWSIGPGHLIKHLRTVQQTSVYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMACLLNSVGLKPIIPDGGYFIIADVSSLGVDLSDVKSDEPYDYKFVKWMTKNKKLSAIPVSAFCDSESKPHFEKLVRFCFIKKDSTLDAAEEIFRTWNSRKS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp