RING2_RAT   Q4KLY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KLY4

Recommended name:E3 ubiquitin-protein ligase RING2

EC number:EC:2.3.2.27

Alternative names:RING finger protein 1B (RING1b) RING finger protein 2 RING-type E3 ubiquitin transferase RING2 Curated

Cleaved into:

GeneID:RGD:1305491

Gene names  (primary ):Rnf2

Gene names  (synonym ):Ring1b

Gene names  (ORF ):

Length:308

Mass:34,242

Sequence:MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVSICQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp