BL1S2_RAT Q32WR5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q32WR5
Recommended name：Biogenesis of lysosome-related organelles complex-1 subunit 2
EC number：
Alternative names：Spinal cord-expressed protein 1
Cleaved into：
GeneID：293938
Gene names (primary )：Bloc1s2
Gene names (synonym )：Rsep1, Sep1
Gene names (ORF )：
Length：142
Mass：16,067
Sequence：MAAAAEGVPATRREEPPRDDAAVETAEEAKEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Tissue specificity：Widely expressed. Highly expressed in most brain regions, spinal cord, kidney and ovary. In the brain, expressed in the frontal cortex and the superior thalamic radiation, with the strongest expression in the granule cells of hippocampal CA1, CA3 and dentate gyrus regions. In the spinal cord, mainly expressed in the gray matter. Expression level is high in laminae I-II and V-VI small sensory neurons in the dorsal horn, as well as in the large motor neurons of the ventral horn. 1
Induction：
Developmental stage：Overexpressed in injured nerves. 1
Protein families：