AT5G1_RAT Q06645
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06645
Recommended name：ATP synthase F(0) complex subunit C1, mitochondrial Curated
EC number：
Alternative names：
Cleaved into：
GeneID：29754
Gene names (primary )：Atp5mc1
Gene names (synonym )：Atp5g1
Gene names (ORF )：
Length：136
Mass：14,244
Sequence：MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：