SGK1_RAT Q06226
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06226
Recommended name：Serine/threonine-protein kinase Sgk1
EC number：EC:2.7.11.1
Alternative names：Serum/glucocorticoid-regulated kinase 1
Cleaved into：
GeneID：
Gene names (primary )：Sgk1
Gene names (synonym )：Sgk
Gene names (ORF )：
Length：430
Mass：48,927
Sequence：MTVKTEAARSTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKLANNSYACKHPEVQSYLKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHIFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPSSIGRSPDSILVTASVKEAAEAFLGFSYAPPMDSFL
Tissue specificity：Expressed in most tissues with highest levels in the ovary, thymus and lung. In the kidney, expressed within glomeruli of the cortex, at low levels in outer medulla and moderate levels in inner medulla and papilla. 1
Induction：
Developmental stage：Up-regulated by aldosterone in distal nephron (tubules) of the kidney. By dexamethasone and serum. By tumor suppressor p53 in mammary epithelial tumor cells. By FSH in granulosa cells. By injury to the central nervous system. 4 s
Protein families：