PDGFB_RAT Q05028
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q05028
Recommended name：Platelet-derived growth factor subunit B
EC number：
Alternative names：PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide
Cleaved into：
GeneID：24628
Gene names (primary )：Pdgfb
Gene names (synonym )：
Gene names (ORF )：
Length：225
Mass：25,603
Sequence：LPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVESESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVTRSPGTSREHRAKTPQTRVTVRTVRIRRPPKGKHRKFKHTHDKK
Tissue specificity：Expressed in a distinct subpopulation of smooth muscle cells in injured arteries.
Induction：
Developmental stage：
Protein families：