BMP6_RAT Q04906
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q04906
Recommended name：Bone morphogenetic protein 6
EC number：
Alternative names：VG-1-related protein (VGR-1)
Cleaved into：
GeneID：25644
Gene names (primary )：Bmp6
Gene names (synonym )：Bmp-6, Vgr
Gene names (ORF )：
Length：506
Mass：56,223
Sequence：MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSSSSGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQSPVLPQQQQSQQTAREEPPPGRLKSAPLFMLDLYNSLSKDDEEDGVSEGEGLEPESHGRASSSQLKQPSPGAAHSLNRKSLLAPGPGGSASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHINPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSSASDYNSSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Tissue specificity：
Induction：
Developmental stage：
Protein families：