HES5_RAT   Q03062


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03062

Recommended name:Transcription factor HES-5

EC number:

Alternative names:

Cleaved into:

GeneID:79225

Gene names  (primary ):Hes5

Gene names  (synonym ):Hes-5

Gene names  (ORF ):

Length:166

Mass:18,452

Sequence:MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW

Tissue specificity:Expressed predominantly in embryonic neural lineage cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp