HES5_RAT Q03062
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q03062
Recommended name:Transcription factor HES-5
EC number:
Alternative names:
Cleaved into:
GeneID:79225
Gene names (primary ):Hes5
Gene names (synonym ):Hes-5
Gene names (ORF ):
Length:166
Mass:18,452
Sequence:MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW
Tissue specificity:Expressed predominantly in embryonic neural lineage cells. 1
Induction:
Developmental stage:
Protein families: