SIAT6_RAT Q02734
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02734
Recommended name：CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
EC number：EC:2.4.3.6
Alternative names：Beta-galactoside alpha-2,3-sialyltransferase 3 (Alpha 2,3-ST 3) Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase N-acetyllactosaminide alpha-2,3-sialyltransferase ST3Gal III (ST3GalIII) ST3N Sialyltransferase 6
Cleaved into：
GeneID：64445
Gene names (primary )：St3gal3
Gene names (synonym )：Siat6
Gene names (ORF )：
Length：374
Mass：42,082
Sequence：MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALDGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Tissue specificity：Found in all tissues tested. High expression found in brain, liver, kidney, colon, heart and lung.
Induction：
Developmental stage：
Protein families：