MCHR1_RAT   P97639


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97639

Recommended name:Melanin-concentrating hormone receptor 1 1 Publication

EC number:

Alternative names:G-protein coupled receptor 24 MCH-1R (MCH1R; MCHR) SLC-1 Somatostatin receptor-like protein

Cleaved into:

GeneID:83567

Gene names  (primary ):Mchr1

Gene names  (synonym ):Gpr24, Slc1

Gene names  (ORF ):

Length:353

Mass:39,063

Sequence:MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT

Tissue specificity:High level in the brain, moderate amounts in the eye and skeletal muscle, and small amounts in tongue and pituitary.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp