PTGR1_RAT P97584
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97584
Recommended name：Prostaglandin reductase 1
EC number：
Alternative names：15-oxoprostaglandin 13-reductase 1 Publication (EC:1.3.1.48 By Similarity) . EC:1.3.1.48 (UniProtKB | ENZYME | Rhea) By Similarity Dithiolethione-inducible gene 1 protein 1 Publication (D3T-inducible gene 1 protein 1 Publication; DIG-1 1 Publication) Leukotriene B4 12-hydroxydehydrogenase 1 Publication NAD(P)H-dependent alkenal/one oxidoreductase (EC:1.3.1.74 1 Publication) . EC:1.3.1.74 (UniProtKB | ENZYME | Rhea) 1 Publication
Cleaved into：
GeneID：192227
Gene names (primary )：Ptgr1
Gene names (synonym )：Dig1, Ltb4dh
Gene names (ORF )：
Length：329
Mass：35,718
Sequence：MVQAKTWTLKKHFEGFPTDSNFELRTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDSMMGEQVARVVESKNSAFPTGTIVVALLGWTSHSISDGNGLRKLPAEWPDKLPLSLALGTVGMPGLTAYFGLLDICGLKGGETVLVNAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAICGAISQYNRTGPCPPGPSPEVIIYQQLRMEGFIVTRWQGEVRQKALTDLMNWVSEGKIRYHEYITEGFEKMPAAFMGMLKGDNLGKTIVKA
Tissue specificity：Up-regulated by 1,2-dithiole-3-thione (D3T). 1
Induction：
Developmental stage：
Protein families：