EDF1_RAT   P69736


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P69736

Recommended name:Endothelial differentiation-related factor 1

EC number:

Alternative names:Calmodulin-associated peptide 19 (CAP-19) Multiprotein-bridging factor 1 (MBF1)

Cleaved into:

GeneID:296570

Gene names  (primary ):Edf1

Gene names  (synonym ):

Gene names  (ORF ):

Length:148

Mass:16,369

Sequence:MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK

Tissue specificity:Expressed in cardiomyocytes, cortical and hippocampal neurons. 2 s

Induction:Expressed in newborn and adult heart and brain tissues. Expression is not evident in prenatal days. 2 Publications

Developmental stage:Up-regulated upon cardiomyocytes hypertrophy.

Protein families:


   💬 WhatsApp