CYH2_RAT P63035
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63035
Recommended name：Cytohesin-2
EC number：
Alternative names：
Cleaved into：
GeneID：116692
Gene names (primary )：Cyth2
Gene names (synonym )：Pscd2, Sec7b
Gene names (ORF )：
Length：400
Mass：46,571
Sequence：MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Tissue specificity：Present in all tissues tested, with highest protein levels in brain and adrenal. 1
Induction：
Developmental stage：On embryonic days 15 (15 dpc) and 18 dpc, a weak expression is seen in the mantle and ventricular germinal zones throughout the neuraxis. On postnatal days 0 (P0) and P7, weakly expressed in the gray matter, but not in the white matter, throughout the brain. In the cerebellum, the expression is seen in the external granule cell layer. 1
Protein families：