GBRAP_RAT   P60517


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60517

Recommended name:Gamma-aminobutyric acid receptor-associated protein Curated

EC number:

Alternative names:

Cleaved into:

GeneID:58974

Gene names  (primary ):Gabarap

Gene names  (synonym ):

Gene names  (ORF ):

Length:117

Mass:13,918

Sequence:MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Tissue specificity:Expressed in brain (at protein level) (PubMed:25172774). Can be found in both somatodendritic and axonal compartment of neurons (PubMed:11461150). 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp