CDN2B_RAT P55272
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55272
Recommended name：Cyclin-dependent kinase 4 inhibitor B
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cdkn2b
Gene names (synonym )：Ink4
Gene names (ORF )：
Length：130
Mass：13,749
Sequence：MLGGGSDAGLATAAARGQVETVRQLLEAGADPNAVNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLMVLHKAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
Tissue specificity：Expression abundant in lung, less abundant in testis, barely detectable in liver, and not detectable in neonatal kidney, adult kidney, brain, heart, or spleen.
Induction：
Developmental stage：
Protein families：