AIF1_RAT P55009
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55009
Recommended name：Allograft inflammatory factor 1
EC number：
Alternative names：Ionized calcium-binding adapter molecule 1 MRF-1 Microglia response factor
Cleaved into：
GeneID：29427
Gene names (primary )：Aif1
Gene names (synonym )：Iba1, Mrf1
Gene names (ORF )：
Length：147
Mass：16,827
Sequence：MSQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Tissue specificity：Cardiac allograft, spleen and testis. Expressed by inflammatory cells (macrophages and neutrophils).
Induction：Expressed early and persistently in chronically rejecting cardiac allografts but is absent in cardiac syngrafts and host hearts. In the embryonic cerebellum, expression peaks at day 7.
Developmental stage：By interferon gamma.
Protein families：