SYT5_RAT P47861
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47861
Recommended name:Synaptotagmin-5
EC number:
Alternative names:
Cleaved into:
GeneID:54309
Gene names (primary ):Syt5
Gene names (synonym ):
Gene names (ORF ):
Length:386
Mass:43,127
Sequence:MFPEPPTPGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDPSPSMPGQQVLDKHQLGRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGTAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP
Tissue specificity:Expressed in kidney, adipose tissue, lung and heart, as well as at higher levels in brain.
Induction:
Developmental stage:
Protein families: