APEX1_RAT P43138
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P43138
Recommended name:DNA repair nuclease/redox regulator APEX1
EC number:EC:3.1.11.2
Alternative names:APEX nuclease (APEN) Apurinic-apyrimidinic endonuclease 1 (AP endonuclease 1) Redox factor-1 (REF-1)
Cleaved into:
GeneID:79116
Gene names (primary ):Apex1
Gene names (synonym ):Ape, Apex, Ref1
Gene names (ORF ):
Length:317
Mass:35,538
Sequence:MPKRGKRAAAEDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSASGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFILVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGEMLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Tissue specificity:
Induction:
Developmental stage:
Protein families:DNA repair enzymes AP/ExoA family