REG3G_RAT P42854
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P42854
Recommended name：Regenerating islet-derived protein 3-gamma
EC number：
Alternative names：Pancreatitis-associated protein 3 Regenerating islet-derived protein III-gamma (Reg III-gamma)
Cleaved into：
GeneID：24620
Gene names (primary )：Reg3g
Gene names (synonym )：Pap3
Gene names (ORF )：
Length：174
Mass：19,144
Sequence：MLPRVALTTMSWMLLSSLMLLSQVQGEDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
Tissue specificity：Expressed in injured skeletal muscles and sciatic nerve (at protein level). Expressed in the pancreas. Expression increases during the acute phase of pancreatitis. 2 s
Induction：
Developmental stage：Up-regulated in injured skeletal muscles and peripheral nerve. 1
Protein families：