CAV1_RAT   P41350


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P41350

Recommended name:Caveolin-1

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Cav1

Gene names  (synonym ):Cav

Gene names  (ORF ):

Length:178

Mass:20,553

Sequence:MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI

Tissue specificity:Cortex and inner medulla of kidney (at protein level). Expressed in the hippocampus. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp