CDK4_RAT   P35426


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35426

Recommended name:Cyclin-dependent kinase 4

EC number:EC:2.7.11.22

Alternative names:Cell division protein kinase 4 PSK-J3

Cleaved into:

GeneID:94201

Gene names  (primary ):Cdk4

Gene names  (synonym ):

Gene names  (ORF ):

Length:303

Mass:33,799

Sequence:MATTRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPLKRISAFRALQHSYLHKEESDPE

Tissue specificity:Expressed in fetal and adult lung. Also expressed in brain, heart, liver, skeletal muscle and testes. 1

Induction:

Developmental stage:In developing lung, high expression at day 17 after which levels decline to barely detectable levels at birth. Levels then increase postnatally until postnatal day 6 and decline in adulthood. Preferentially expressed in proliferating cells. 1

Protein families:


   💬 WhatsApp