CP4F1_RAT P33274
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P33274
Recommended name：Cytochrome P450 4F1 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cyp4f1 1 Publication
Gene names (synonym )：Cyp4f-1, Cyp4f2
Gene names (ORF )：
Length：524
Mass：59,868
Sequence：MSQLSLSWLGLGPEVAFPWQTLLLFGASWILAQILTQIYAAYRNFRRLRGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYTILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWKRLISEGSSRLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLLFMDLLYNLTPDGMRFHKACNLVHEFTDAVIRERRRTLPDQGLDEFLKSKAKSKTLDFIDVLLLTKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLANDPEYQERCRQEVQELLRDRDPEEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYNPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEGGLWLRVEPLTAGAQ
Tissue specificity：Expressed in liver. 1
Induction：
Developmental stage：
Protein families：