C1QB_RAT P31721
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31721
Recommended name：Complement C1q subcomponent subunit B
EC number：
Alternative names：
Cleaved into：
GeneID：29687
Gene names (primary )：C1qb
Gene names (synonym )：
Gene names (ORF )：
Length：253
Mass：26,589
Sequence：MKTQWSEILTPLLLLLLGLLHVSWAQSSCTGSPGIPGVPGIPGVPGSDGKPGTPGIKGEKGLPGLAGDHGELGEKGDAGIPGIPGKVGPKGPVGPKGAPGPPGPRGPKGGSGDYKATQKVAFSALRTVNSALRPNQAIRFEKVITNVNDNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNIVRGRDRDRMQKVLTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGVEGANSIFTGFLLFPDMDV
Tissue specificity：Highest levels in spleen, lung and brain. Weaker expression in kidney and liver. In the spleen, localized mainly to the red pulp, in cells mainly of monocyte-macrophage lineage. In white pulp, localized in specific dendritic cells such as those from the periarteriolar lymphatic sheath (PALS). 1
Induction：
Developmental stage：
Protein families：