PEBP1_RAT P31044
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31044
Recommended name:Phosphatidylethanolamine-binding protein 1
EC number:
Alternative names:23 kDa morphine-binding protein HCNPpp P23K
Cleaved into:
GeneID:29542
Gene names (primary ):Pebp1
Gene names (synonym ):Pbp, Pebp
Gene names (ORF ):
Length:187
Mass:20,801
Sequence:MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAGK
Tissue specificity:Major component of epididymal secretions and sperm plasma membranes. It is present in cytosols from a variety of other tissues. Highly expressed in brain.
Induction:
Developmental stage:
Protein families: