LYAM1_RAT   P30836


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30836

Recommended name:L-selectin

EC number:

Alternative names:CD62L

Cleaved into:

GeneID:

Gene names  (primary ):Sell

Gene names  (synonym ):Lnhr, Ly-22

Gene names  (ORF ):

Length:372

Mass:42,441

Sequence:MVFPWRCQSAQRGSWSFLKLWIRTLLCCDLLPHHGTHCWTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSQERMDDPY

Tissue specificity:Expressed in peripheral blood mononuclear cells (PBMC), spleen and thymus. 1

Induction:

Developmental stage:Down-regulated by mitogen stimulation of PBMC and spleen T-cells. 1

Protein families:


   💬 WhatsApp