AQP1_RAT P29975
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29975
Recommended name：Aquaporin-1 Curated
EC number：
Alternative names：Aquaporin-CHIP
Cleaved into：
GeneID：25240
Gene names (primary )：Aqp1
Gene names (synonym )：Chip28
Gene names (ORF )：
Length：269
Mass：28,857
Sequence：MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLENSLGRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Tissue specificity：Erythrocytes and renal tubules.
Induction：
Developmental stage：
Protein families：MIP/aquaporin (TC 1.A.8) family