BTG2_RAT P27049
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27049
Recommended name:Protein BTG2
EC number:
Alternative names:
Cleaved into:
GeneID:29619
Gene names (primary ):Btg2
Gene names (synonym ):Pc3
Gene names (ORF ):
Length:158
Mass:17,728
Sequence:MSHGKRTDMLPEIAAAVGFLTSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVATSYGLLTCKNQMMLGRSSPSKNYVMTVSS
Tissue specificity:In brain at embryonic day 13.5, placenta, amnion, and spleen, which are proliferating and/or differentiating.
Induction:
Developmental stage:By nerve growth factor. At lower levels by epidermal growth factor and membrane depolarization. At much lower levels by fibroblast growth factor and interleukin 6.
Protein families: