IOD1_RAT P24389
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24389
Recommended name：Type I iodothyronine deiodinase
EC number：EC:1.21.99.3
Alternative names：5DI DIOI Type 1 DI Type-I 5'-deiodinase
Cleaved into：
GeneID：25430
Gene names (primary )：Dio1
Gene names (synonym )：Itdi1, Txdi1
Gene names (ORF )：
Length：257
Mass：29,730
Sequence：MGLSQLWLWLKRLVIFLQVALEVATGKVLMTLFPERVKQNILAMGQKTGMTRNPRFAPDNWVPTFFSIQYFWFVLKVRWQRLEDRAEYGGLAPNCTVVRLSGQKCNVWDFIQGSRPLVLNFGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQDRLRAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKPGPWNYNPEEVRAVLEKLCIPPGHMPQF
Tissue specificity：Highly expressed in the liver, kidney and thyroid gland. 1
Induction：
Developmental stage：
Protein families：