CRYAB_RAT P23928
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23928
Recommended name：Alpha-crystallin B chain
EC number：
Alternative names：
Cleaved into：
GeneID：25420
Gene names (primary )：Cryab
Gene names (synonym )：
Gene names (ORF )：
Length：175
Mass：20,089
Sequence：MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK
Tissue specificity：Lens as well as other tissues.
Induction：
Developmental stage：Levels are low in both the slow-twitch soleus and fast-twitch rectus femoris muscles at prenatal day 2, then increase slowly until postnatal day 3. At 2 weeks, levels in the rectus femoris muscle then decrease while those in the soleus muscle increase sharply, reaching adult levels by 4 weeks. 1
Protein families：