CDO1_RAT P21816
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21816
Recommended name：Cysteine dioxygenase type 1
EC number：EC:1.13.11.20
Alternative names：Cysteine dioxygenase type I (CDO; CDO-I)
Cleaved into：
GeneID：81718
Gene names (primary )：Cdo1
Gene names (synonym )：
Gene names (ORF )：
Length：200
Mass：23,026
Sequence：MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN
Tissue specificity：Highest levels in liver. Significant expression also in kidney, lung and brain. 2 s
Induction：From neonate to weaning.
Developmental stage：By increase of sulfur amino acid intake. 1
Protein families：