MYF6_RAT   P19335


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P19335

Recommended name:Myogenic factor 6

EC number:

Alternative names:Muscle-specific regulatory factor 4

Cleaved into:

GeneID:25714

Gene names  (primary ):Myf6

Gene names  (synonym ):Mrf4

Gene names  (ORF ):

Length:242

Mass:26,987

Sequence:MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFLRTCSPQWPSVSDHSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVVEK

Tissue specificity:Skeletal muscle in late fetal and adult rats.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp