INHA_RAT   P17490


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17490

Recommended name:Inhibin alpha chain

EC number:

Alternative names:

Cleaved into:

GeneID:24504

Gene names  (primary ):Inha

Gene names  (synonym ):

Gene names  (ORF ):

Length:366

Mass:39,497

Sequence:MVIQPSLLLLLLLTLQDVDSCQGPELVRELVLAKVKALFLDALGPPAMDGEGGGPGIRRLPRRHALGGFMHRTSEPEEEDVSQAILFPATGATCEDQAAAGGLAQEPEEGLFTYVFRPSQHIRSHQVTSAQLWFHTGLDRKSTAASNSSRPLLDLLVLSSGGPMAVPVSLGQSPPRWAVLHLAASAFPLLTHPILVLLLRCPLCSCSGRPETTPFLVAHTRARAPSAGERARRSAPSMPWPWSPAALRLLQRPPEEPSAHAFCHRAALNISFQELGWDRWIVHPPSFIFHYCHGSCGMPTSDLPLPVPGAPPTPAQPLFLVPGAKPCCAALPGSMRSLRVRTTSDGGYSFKYEMVPNLITQHCACI

Tissue specificity:Mainly expressed in ovary and testis. Alpha- and beta-B-subunits are the predominant forms found in testis. Also found in placenta, pituitary, adrenal gland, bone marrow, kidney, spinal cord and brain. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp