CEAM1_RAT   P16573


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P16573

Recommended name:Cell adhesion molecule CEACAM1 Curated

EC number:

Alternative names:CD66a

Cleaved into:

GeneID:

Gene names  (primary ):Ceacam1

Gene names  (synonym ):

Gene names  (ORF ):

Length:519

Mass:57,410

Sequence:MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK

Tissue specificity:Expressed in epithelia, vessel endothelia, leukocytes and platelets. Isoform 1 and isoform 2 are highly expressed in liver and intestine, moderately in lung, and weakly in muscle, kidney, and spleen (PubMed:8454589). Expressed in granulocytes, lymphocytes, granulocytes, B cells, and T-cells (PubMed:11994468). 2 s

Induction:

Developmental stage:

Protein families:immunoglobulin superfamily


   💬 WhatsApp