KCNE1_RAT P15383
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15383
Recommended name：Potassium voltage-gated channel subfamily E member 1
EC number：
Alternative names：
Cleaved into：
GeneID：25471
Gene names (primary )：Kcne1
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：14,699
Sequence：MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Tissue specificity：Expressed in the heart (PubMed:19219384, PubMed:2183220). Expressed in kidney (PubMed:2344412). Expressed in estrogen-induced uterus (PubMed:2344412). 3 s
Induction：
Developmental stage：By estrogen. 1
Protein families：