SIAT1_RAT P13721
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13721
Recommended name：Beta-galactoside alpha-2,6-sialyltransferase 1
EC number：EC:2.4.3.1
Alternative names：Alpha 2,6-ST 1
Cleaved into：
GeneID：
Gene names (primary )：St6gal1
Gene names (synonym )：Siat1
Gene names (ORF )：
Length：403
Mass：46,754
Sequence：MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC
Tissue specificity：Expressed in hepatocytes (at protein level) (PubMed:11278697, PubMed:3121604). Strongly expressed in liver, spleen, lung, kidney and submaxillary gland and weakly in heart and brain (PubMed:1733948, PubMed:2793863). 4 s
Induction：Expressed in kidney, but not in liver. 2 Publications
Developmental stage：Expressed in liver. 1
Protein families：