PRR7_RAT   P0C6T3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C6T3

Recommended name:Proline-rich protein 7

EC number:

Alternative names:

Cleaved into:

GeneID:498704

Gene names  (primary ):Prr7

Gene names  (synonym ):

Gene names  (ORF ):

Length:269

Mass:30,377

Sequence:MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

Tissue specificity:Expressed in brain (PubMed:15629447, PubMed:27458189). Expressed in the cerebral cortex and especially in hippocampal neural cells (at protein level) (PubMed:15629447, PubMed:27458189). 2 s

Induction:

Developmental stage:Expression detected at postnatal day 7 and expression increases until 4 weeks after birth. 1

Protein families:


   💬 WhatsApp