PTPM1_RAT   P0C089


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C089

Recommended name:Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Curated

EC number:EC:3.1.3.27

Alternative names:Protein-tyrosine phosphatase mitochondrial 1 (EC:3.1.3.16 1 Publication, EC:3.1.3.48 PROSITE-ProRule Annotation) . EC:3.1.3.16 (UniProtKB | ENZYME | Rhea) 1 Publication, EC:3.1.3.48 (UniProtKB | ENZYME | Rhea) PROSITE-ProRule Annotation

Cleaved into:

GeneID:

Gene names  (primary ):Ptpmt1

Gene names  (synonym ):

Gene names  (ORF ):

Length:193

Mass:21,886

Sequence:MAASAWLEAGLARVLFYPTLLYTVFRGRVGGPAHRDWYHRIDHTVLLGALPLRSMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEILKEFHKEIAARAAKN

Tissue specificity:Expressed in liver and in pancreatic beta cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp