IL3_RAT P04823
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04823
Recommended name:Interleukin-3
EC number:
Alternative names:Hematopoietic growth factor Mast cell growth factor (MCGF) Multipotential colony-stimulating factor P-cell-stimulating factor
Cleaved into:
GeneID:
Gene names (primary ):Il3
Gene names (synonym ):Il-3
Gene names (ORF ):
Length:166
Mass:18,631
Sequence:MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Tissue specificity:Activated T-cells, mast cells, natural killer cells.
Induction:
Developmental stage:
Protein families: