MUP_RAT P02761
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02761
Recommended name：Major urinary protein
EC number：
Alternative names：Allergen Rat n I Alpha(2)-euglobulin Alpha-2u-globulin alpha-2u globulin PGCL1
Cleaved into：
GeneID：298109
Gene names (primary )：UP000002494
Gene names (synonym )：Chromosome 5
Gene names (ORF )：
Length：181
Mass：20,737
Sequence：MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG
Tissue specificity：Abundant in the urine of adult male rats but absent from that of females.
Induction：
Developmental stage：Synthesis of this protein in the hepatic parenchymal cells is induced in vivo by androgens, glucocorticoids, growth hormone, and insulin, and inhibited by estrogens.
Protein families：