ARL2_RAT O08697
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08697
Recommended name:ADP-ribosylation factor-like protein 2
EC number:
Alternative names:
Cleaved into:
GeneID:65142
Gene names (primary ):Arl2
Gene names (synonym ):Arl184
Gene names (ORF ):
Length:184
Mass:20,836
Sequence:MGLLTILKKMKQKERDVRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD
Tissue specificity:Expressed in brain, retina, lung, cerebellum, liver, kidney, hippocampus, spleen, cortex and heart (at protein level). 3 s
Induction:
Developmental stage:
Protein families: