LYPD6_RAT D3ZTT2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZTT2
Recommended name：Ly6/PLAUR domain-containing protein 6
EC number：
Alternative names：
Cleaved into：
GeneID：679564
Gene names (primary )：Lypd6
Gene names (synonym )：
Gene names (ORF )：
Length：171
Mass：19,051
Sequence：MEPSPALAWLLLLSLVADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRDTRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGYKICTSCCEGNICNLPLPRNDTDATFATTSPINQTNGHPHCVSVIVSCLWVWLGLTL
Tissue specificity：Expressed at high levels in the cortex and cerebellum of the brain, at moderate levels in the lung, kidney, and liver, and at low levels in the heart and prostate (at protein level) (PubMed:27344019). Expressed in neurons (at protein level) (PubMed:34631692). 2 s
Induction：
Developmental stage：Highly expressed during early development, showing high levels in the first postnatal days, followed by a decrease toward adulthood. 1
Protein families：