TPRGL_RAT A8WCF8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A8WCF8
Recommended name：Tumor protein p63-regulated gene 1-like protein By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：687090
Gene names (primary )：Tprg1l
Gene names (synonym )：Mover 3 Publications
Gene names (ORF )：
Length：266
Mass：29,844
Sequence：MLQLRDTVDSAGTSPTAVLAAGEDAGAGRQGAGTPLRQTLWPLNVHDPTRRARVKEYFVFRPGTIEQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTDQSLLICKYDFISLQCQQVVRVALSAVDTISCGEFQFPPKSLNKREGFGVRIQWDKQSRPSFINRWNPWSTNMPYATFIEHPMAGMDEKTASLCHLESFKALLIQAVKKAQKESPLPGQANNVLVLDRPLLIETYVGLMSFINNEAKLGYSMTRGKIGF
Tissue specificity：Highest levels in brain with lower levels in testis. Weakly expressed in heart, spleen and liver. In the hippocampal CA3 region, localizes to mossy fiber terminals but is absent from inhibitory nerve terminals. Localizes to inhibitory terminals throughout the cerebellar cortex (at protein level) (PubMed:17869247). Expressed in the calyx of Held (PubMed:26212709). 2 s
Induction：
Developmental stage：
Protein families：