RGCC_RAT Q9Z2P4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2P4
Recommended name：Regulator of cell cycle RGCC
EC number：
Alternative names：
Cleaved into：
GeneID：117183
Gene names (primary )：Rgcc
Gene names (synonym )：Rgc32
Gene names (ORF )：
Length：137
Mass：14,766
Sequence：MKPPSTQSSPAAVAAAAPAMDSAAAADLTDVLCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRDSFTFSDEKLNSPTDSTPALLSSAVTPRKAKLGDTKELEDFIADLDRTLASM
Tissue specificity：Detected in kidney, heart, brain, lung, skin, spleen and thymus. 1
Induction：
Developmental stage：Up-regulated in oligodendrocytes in response to complement activation. 1
Protein families：